PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AMDW01037147.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 158aa    MW: 17285.7 Da    PI: 6.7986
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AMDW01037147.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS176.91.5e-541315376227
                   GRAS  76 eelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetge 163
                            +++aa+++f+ +sP++kfsh+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g+    s e+le+tg+
  AMDW01037147.1_FGP001  13 RVAAAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGA----SMEALEATGK 96 
                            567899********************************************************************....********** PP

                   GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdev 227
                            rL++fA++lg+pfef + va++  +l++e+L v ++Ea+aV++    h+l+d ++s ++    +
  AMDW01037147.1_FGP001  97 RLSDFADTLGLPFEFCP-VADKAGNLDPEKLGVTRREAVAVHWLR--HSLYDVTGSDSN----T 153
                            *****************.7************************98..888877777766....4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.891158IPR005202Transcription factor GRAS
PfamPF035145.1E-5213153IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
PSPSPAGARV HGRVAAAFQV FNGISPFVKF SHFTANQAIQ EAFEREERVH IIDLDIMQGL  60
QWPGLFHILA SRPGGPPRVR LTGLGASMEA LEATGKRLSD FADTLGLPFE FCPVADKAGN  120
LDPEKLGVTR REAVAVHWLR HSLYDVTGSD SNTLWLIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-26115463221GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2431310.0AK243131.1 Oryza sativa Japonica Group cDNA, clone: J100030A12, full insert sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0005060.0BX000506.4 Oryza sativa chromosome 12, . BAC OJ1311_G04 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620600.11e-110PREDICTED: protein SCARECROW 2
SwissprotA2ZHL01e-111SCR2_ORYSI; Protein SCARECROW 2
SwissprotQ2QYF31e-111SCR2_ORYSJ; Protein SCARECROW 2
TrEMBLI1R3J71e-111I1R3J7_ORYGL; Uncharacterized protein
STRINGORGLA12G0010300.11e-111(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.12e-86GRAS family protein